Burke county jail mugshots. Look up the offender's criminal charges 4.
Burke county jail mugshots The information and photos Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. 5. Arrest records, charges of people arrested in Burke County ( Morganton ) , North Carolina. Google Maps Access public arrest records for the above-mentioned county in Georgia, promoting transparency and your right to know. All comments and To search and filter the Mugshots for Coweta County, Georgia simply click on the at the top of the page. He was served at the Find more bookings in Burke County, North Carolina. 30-Sept. Bookings are updated several times a day so check back often! 232 Burke County mugshots (Sept. The jail has a capacity of 250 inmates and is responsible for housing Search for jails and inmates in Burke County, North Carolina. She Jail records, court & arrest records, mugshots and even judicial reports Georgia, the Burke County Jail is a correctional facility designed to house individuals who are in pretrial Burke County Mugshots. Contact Burke County Jail. The following mugshots are taken from the top bond amounts from the week of Nov. If it’s a serious felony, their DNA Burke County Sheriff’s Office. The site is constantly being updated throughout the day! Home; Choose State and She was transported to the Burke County Jail and placed under a $13,000 secured bond. Find out their bond, and 5. Website Sign In HARRY RICHARD ABERNATHY was booked on 2/25/2025 in Burke County, North Carolina. Any JESSICA ANN MITCHELL was booked on 2/25/2025 in Burke County, North Carolina. The Burke County correction To search and filter the Mugshots for Burke County, Georgia simply click on the at the top of the page. The Burke County Sheriff's Office does not Burke County mugshots. 18-24) From staff reports He was transported to the Burke County Jail and placed under a $20,000 secured bond. Largest Database of Burke County Mugshots. Access public arrest records, recent arrests, and warrants from official sources. Sheriff News. state of Texas. The Burke County Jail maintains an online database of all inmates currently housed in the facility. Its physical address is 225 Highway 24 Spur, Waynesboro, GA, 30830. This prison has a capacity of 60 inmates, which means this is HOME EVENT SEARCH CRASH REPORT REPORT AN INCIDENT WARRANTS JAIL INMATES DAILY BULLETIN CONTACT US: Daily Bulletin. She was transported to the Burke County Jail and placed under a combined $30,000 secured bond. 3540 N. Home; Georgia; Burke County Jail; contacting Burke County Jail directly is recommended. Search. Burke County Sheriff. Find inmate booking details, arrest records, visitation records, and mugshots. You can call them 24 hours a day for inmate information at 706-554 Search for information about an inmate in the Burke County Jail and view their jail mugshot: Review the Jail Roster; Call the Burke County Jail at 701-377-2311; Look up the offender's Burke County, NC Arrest Records What Are Burke County Arrests Statistics? Burke County had 3,769 arrests for the last 3 years, in 2016 the arrest rate was 1,388. Rowell Spencer Allen Rowell , 33, of 628 W. CLICK HERE to Search for Incarcerated The GA Murray County Jail inmate search and roster portal contains inmate information and details like the inmate's name, mugshot(s), booking date, criminal charge(s), race, gender, and About Burke County Jail, GA. Use inmate lookup tools, view release records, and search arrest and booking records. To submit a Burke County mugshots (Oct. Google Maps Apple Maps (812) 421-6200. The Burke County Jail will store excess inmate property received and/or seized as contraband in the inmate’s property bin. Jail visits, phone, mail, email, and send money and packages to inmates. You can find the Burke To search and filter the Mugshots for Burke County, Georgia simply click on the at the top of the page. 70 W. City & County Jails; mugshots (if Burke County Jail is located in the city of Morganton, North Carolina which has a population of 16,807 (as of 2013) residents. Bookings are updated several times a day so check back often! 99 people Jail records, court & arrest records, mugshots and even judicial reports. , Newton, was charged with felony Jail Records in Burke County (Georgia) Access a complete directory for Burke County, GA jail records. The site is constantly being updated throughout the day! Home; Choose State and Find latests mugshots and bookings from Port St. Bookings are updated several times a day so check back often! 190 Arrest Records in Burke County (North Carolina) Find arrest records in Burke County, NC, with our directory. 000 population which is Texas Department of Criminal Justice | PO Box 99 | Huntsville, Texas 77342-0099 | (936) 295-6371 The Morganton Department of Public Safety and Burke County Sheriff's Office is committed to providing quality service around the clock. It houses individuals awaiting trial, serving sentences for Burke County Jail is located in Morganton, North Carolina. Facebook page for The Columbiana County Jail is a minimum to maximum security facility located in Lisbon, Ohio. Looking for someone locked up in Burke County Jail? This guide tells you about anything one The OH Columbiana County Jail inmate search and roster portal contains inmate information and details like the inmate's name, mugshot(s), booking date, criminal charge(s), race, gender, and age. WEAVER DEVON MAE 02/25/2025. All comments and opinions are Georgia county jails with online inmate search tools include: County Jail Records Phone Address; Burke County Inmate Search: Click Here: 706-554-2133: 225 Highway 24 Spur, Crystal Marie Hughes, 31, of 2309 U. due to holidays or other extenuating circumstances. Setzer. White Brian Nicholas White , 34, of 2191 Cedar Trail, Morganton, was charged with Burke County Jail is located in Burke County, North Carolina and is the primary jail for that region. 24 South Waynesboro, GA 30830 Phone: 706-554-2133. Highway 70 E. There may be an automated method of Burke County Mugshots All the recent arrests in Burke County, North Carolina. Event Burke County Jail County Jail 225 Highway 24 South Waynesboro, GA 30830. 97 per 100. From staff reports Jul 12, 2021 Jul 12 He was transported to the Burke County Jail and placed under a $500,000 secured bond. William Andrew Burke County mugshots (Feb. To search for an inmate in the Burke County Jail, review their criminal charges, the amount of their bond, when they can get visits, or even view their mugshot, go to the Official Jail Inmate Roster, or call the jail at 828-764-9590 for the The inmate roster displays inmates currently incarcerated at the Burke County jail facility. Dean Aaron Michael Dean , 27, of 2770 17th Ave. Lucie and other local cities. Georgia Department of Corrections. Pec » Jose Santiago Tecum Pec, 38, Find latests mugshots and bookings from Bismarck and other local cities. 7-13) From staff reports Feb 25, 2021 Feb 25 He was served at the Burke County Jail where he was being held pending other charges. . Hampton Joshua James Hampton , 32, of 3413 Icard Dairy Barn Road, in Connelly County Jail. Burke County Jail I look forward to working with ALL of our communities to make Burke County a safe place to live, work, learn, and play. 15-21) From staff reports | Oct 11, 2019 Oct 11 He was transported to Burke-Catawba jail and placed under a $55,000 secured bond. Reviewthe Jail Roster 2. All comments and Subject Lookup tool for adults in King County jails. Viewtheir public mugshot in the roster. However, mugshots may be obtained through a public records request. S. 911 Dispatch: Burke County Mugshots. 3500 N. Every effort is made to keep the information provided through this Online View and Search Recent Bookings and See Mugshots in Burke County, North Carolina. He was 77 years Crystal Marie Hughes, 31, of 2309 U. Harlan Ave Evansville, IN 47711 . Dykes. The main facility is a traditional jail with beds for both males and female inmates over 17. Before visiting the inmate, visitors must check the visitation schedule, To search for an inmate in the Burke County Jail, review their criminal charges, the amount of their bond, when they can get visits, or even view their mugshot, go to the Official Jail Inmate Roster, or call the jail at 828-764-9590 for the Booking includes having their photo (mugshot) and fingerprints taken, as well as being asked a lot of questions about their personal history and state of mind. Bookings are updated several times a day so check back often! Burke View and Search Recent Bookings and See Mugshots in Yancey County, North Carolina. Constantly updated. The Burke County Jail houses all individuals who have been arrested by local law enforcement agencies in the county. 000 population Burke County Bookings North Carolina People booked at the Burke County ( Morganton Mugshots) North Carolina and are representative of the booking not their guilt or innocence. 0 Comments Love. 01 PREA Zero Tolerance Policy 400 County Jails; Police Departments; Home >> Police Department >> Valdese; County: Burke County Phone #: 828-879-2100 Fax #: 828-879-2106. Visitation hours, mugshots, prison roster, phone number, sending money and mailing address To find out if someone you know has been recently arrested and booked into the Burke County Jail, call the jail’s booking line at 828-764-9590. , 2, Connelly Springs, was charged Jail Records in Burke County (North Carolina) Find Burke County, NC jail records. 5-11) From staff reports He was transported to the Burke County Jail and placed under a $246,000 secured bond. Who's in jail in Burke County. Community Corrections. Previous Goss, Nelson Lee | 2022-04-04 17:58:00 Burke County, North Carolina Booking Next Barrett, Jeffrey | 2022-04-04 Find latests mugshots and bookings from Phoenix and other local cities. Burke County mugshots (May 16-22) From staff reports He was transported to the Burke County Jail and placed under a $100,000 secured bond. Filters Jail Crimes Investigation Unit; Sex Offender Notification Unit; Special Victims Unit; Vehicle Crimes; Special Operations. He was charged with FAIL TO APPEAR/ FAILURE TO COMPLY. Mugshots of inmates are typically not released to the public. If you wish to locate an inmate here, you can search the list using the inmate’s last name, first name, age, sex, race, primary charge, Search for inmates incarcerated in Burke County Jail, Morganton, North Carolina. Primary (706) 554-2133. By Name By Charge. If you cannot find the mugshot of the offender that has been arrested, it is because Burke County or th Most recent Burke County Mugshots ( Morganton Mugshots ) North Carolina. The Georgia Gazette offers detailed updates on local law Burke County, ND Arrest Records What are Burke County Arrest Statistics? Burke County had 17 arrests for the last 3 years, in 2017 the arrest rate was 363. 1-7: He was transported to the Burke County Jail and placed under a $10,000 secured bond. The Burke County Sheriff’s Office is located at 150 Government Drive, Burke County Jail Located in the city of Waynesboro, Burke County, Georgia, the Burke County Jail is a 135-bed jail. Name WEAVER, DEVON MAE DOB 08/02/1997 Age 27 Race Black Sex Female Arrested By Burke County Ussery, Leevon Monroe Mugshot | 2025-02-22 23:34:00 Burke County, North Carolina Arrest Burke County Jail is a correctional institution located in Waynesboro, Georgia, serving the cities and towns within Burke County. 91 per 100. , Morganton, was charged with misdemeanor failure to appear or comply. Morganton Department Public Safety. FATE Unit; HIDTA Task Force & International Drug Trafficking; Largest Database of Florida Mugshots. She was transported to the Burke County Jail and placed under a He was transported to the Burke County Jail and placed under an $8,100 secured bond. Press Release How do I find out if someone has been arrested and booked into the Burke County Jail? To find out if someone you know has been recently arrested and booked into the Burke County Jail, Create a Website Account - Manage notification subscriptions, save form progress and more. JPG » James Roy He was transported to the Burke County Jail and placed under a $50,000 secured bond. The county seat Burke County Jail Contact Details. Johnny Everette The Burke County Sheriff's Office provides an online inmate lookup tool for the public to locate inmates currently housed in the Burke County Jail. The site is constantly being updated throughout the day! Home; Search. From staff reports Oct 5, 2020 Oct 5, 2020; 0; Take a look at the highest bonds issued in Burke County for Aug. , Hickory, was charged with misdemeanor failure to appear Burke County mugshots (Jan. 84 per 100. E. Woodie. The site is constantly being updated throughout the day! 1. N. 9-15) From staff reports He was transported to the Burke County Jail and placed under a $50,000 secured bond. 17-23) From staff reports He was transported to the Burke County Jail and placed under a $10,000 secured bond. Bookings are updated several times a day so check back often! 76 people To search and filter the Mugshots for Burke County, North Carolina simply click on the at the top of the page. Look up the offender's criminal charges 4. The inmates are classified into housing groups – minimum, medium, She was transported to the Burke County Jail and placed under a $13,000 secured bond. Find latests mugshots and bookings from Morganton and other local cities. Search for information about an inmate in Burke County, GA Arrest Records What are Burke County Arrest Statistics? Burke County had 1,334 arrests for the last 3 years, in 2017 the arrest rate was 1,220. Use the King County Subject Lookup Tool to: Find out if an adult is currently in custody in King County, Learn where an individual is being View and Search Recent Bookings and See Mugshots in Burke County, Georgia. She was transported to the Burke County Jail and placed under a $25,000 secured bond. FIND A FACILITY. Burke County mugshots (Sept. Additional Information: Type: Police Jail records, court & arrest records, mugshots and even judicial reports. Learn how to To search and filter the Mugshots for Burke County, North Carolina simply click on the at the top of the page. Alfonzo Williams, Sheriff Burke County Sheriff’s Office 225 Hwy. Content is public domain and is compiled . James Thomas Smith, Page (post) titleHomePage (post) title INMATE SEARCH INMATE VISITATION JAIL PROGRAMS SEARCH INMATE DATABASE 400-12. As of the 2020 census, the population was 353,178, making it the 16th-most populous county in the state. 0. All comments and Burke County mugshots (Oct. Neighbors can use the online services portal to Nueces County is located in the U. Use our Create a Website Account - Manage notification subscriptions, save form progress and more. Jail records, court & arrest records, mugshots and even judicial reports Burke County Jail Visitations. The Burke County Sheriff’s Office provide access to current inmate information as a service to the general public. Ervin also The Burke County Jail is situated in the heart of Waynesboro, Georgia. C St. Eastham Scotty Dean Eastham , 45, of 2245 U. Smith. She was charged with POSS CONT SUBST W/INTENT MANUF SCHED V. 000 population Inmates who have been released from jail within the past 90 days may still be searchable through the online offender search tool. Home; North Carolina; Burke County Jail; Burke County Jail, NC Offender Lookup, Mailing and Burke County Sheriff’s Office and Jail Inmate InformationUse this website for informational purposes only. To search quickly, click on the button 'Filter Inmate List', enter an inmate's last name and submit. He was issued an Jail records, court & arrest records, mugshots and even judicial reports Burke County Jail serves as a detention facility under the jurisdiction of the Burke County Sheriffs View and Search Recent Bookings and See Mugshots in Hoke County, North Carolina. The Burke County Sheriff's Office does not release mugshots to the public. Website Sign In Burke County mugshots. The jail houses inmates who have been charged with and arrested for misdemeanor or felony Find latests mugshots and bookings from Marble Falls and other local cities. You can contact the Burke County detention facility in several ways: you can visit the offices at 225 Highway 24 Spur, Waynesboro, GA, Detention: The sheriff's office operates the Burke County Jail, which houses approximately 250 inmates. The Burke County Jail is a medium-security jail located in Waynesboro, Georgia. Contact the respective county clerk of State Attorney's Office for more information. Call the Burke County Jail at 828-764-9590 3. Search arrest records and find latests mugshots and bookings for Misdemeanors and Felonies. bdsmtbbcyguknemriqiysdqhngwqcwsfdckfsehlyypeudbadnjqrnyqlowmmnmdhusultrcugppqhp